DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prpk and Tex9

DIOPT Version :9

Sequence 1:NP_647948.1 Gene:Prpk / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006511082.1 Gene:Tex9 / 21778 MGIID:1201610 Length:404 Species:Mus musculus


Alignment Length:117 Identity:26/117 - (22%)
Similarity:47/117 - (40%) Gaps:17/117 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKQGAEGRLYLGDFKGEACLIKERFVKKYRH---PELNTQITR--------QRMKAEAK-ASGRC 58
            |.:.||...:.|..|......:.||:|...|   .||::.:..        |.:|::.| ....|
Mouse   183 LPECAEDDSFCGVSKDIGTEAQIRFLKAKLHVMQEELDSVVCECSKKEDKIQDLKSKVKNLEEDC 247

  Fly    59 LAAGILAPKILHSDLNTHKLYMEYFDAA-KTAKQFIQETVSTQTEDEAKKCL 109
                :...:.:.|..:..:.|...|:.| |...:..|:..|.:.|.|:|:.|
Mouse   248 ----VRQQRTVTSQQSQIEKYKNLFEEANKKCDELQQQLSSVERELESKRRL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpkNP_647948.1 PKc_like 3..224 CDD:304357 26/117 (22%)
Tex9XP_006511082.1 Smc <41..353 CDD:224117 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.