DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prpk and TP53RK

DIOPT Version :9

Sequence 1:NP_647948.1 Gene:Prpk / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_291028.3 Gene:TP53RK / 112858 HGNCID:16197 Length:253 Species:Homo sapiens


Alignment Length:222 Identity:102/222 - (45%)
Similarity:141/222 - (63%) Gaps:4/222 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKAEAKASGRCLAAGILAPK 67
            ||::|||||.|::.|.|:|.|.:||.||.|.||||.|..::.|:|...||:|..||..|||.||.
Human    36 LELVKQGAEARVFRGRFQGRAAVIKHRFPKGYRHPALEARLGRRRTVQEARALLRCRRAGISAPV 100

  Fly    68 ILHSDLNTHKLYMEYFDAAKTAKQFIQETVSTQTEDEAKKCLLEFCTRIGEIIGKMHSNHIIHGD 132
            :...|..::.||||..:.:.|.:.:||.|:.|:...:.   |......||:::.:||...:||||
Human   101 VFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQG---LSNLAKTIGQVLARMHDEDLIHGD 162

  Fly   133 LTTSNILINPKGGDYDVILIDFGLSHYNQATEDKGVDLYVLERALLSTHSEQPYIFEHVLAAYRT 197
            |||||:|:.|.....:::|||||||..:...|||||||||||:|.||||.....:||..|.:|.|
Human   163 LTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYST 227

  Fly   198 ACGKDEQAVLTKFEEVRARGRKRTMIG 224
            : .|..:.||.|.:|||.|||||:|:|
Human   228 S-SKKARPVLKKLDEVRLRGRKRSMVG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpkNP_647948.1 PKc_like 3..224 CDD:304357 101/220 (46%)
TP53RKNP_291028.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Bud32 36..253 CDD:226168 101/220 (46%)
Nuclear localization signal. /evidence=ECO:0000255 78..95 7/16 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150739
Domainoid 1 1.000 118 1.000 Domainoid score I5905
eggNOG 1 0.900 - - E1_COG3642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6042
Inparanoid 1 1.050 195 1.000 Inparanoid score I3834
Isobase 1 0.950 - 0 Normalized mean entropy S1720
OMA 1 1.010 - - QHG62179
OrthoDB 1 1.010 - - D1425238at2759
OrthoFinder 1 1.000 - - FOG0003198
OrthoInspector 1 1.000 - - oto90243
orthoMCL 1 0.900 - - OOG6_101388
Panther 1 1.100 - - LDO PTHR12209
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R156
SonicParanoid 1 1.000 - - X2602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.