DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prpk and tp53rk

DIOPT Version :9

Sequence 1:NP_647948.1 Gene:Prpk / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002933205.2 Gene:tp53rk / 100127196 XenbaseID:XB-GENE-484888 Length:237 Species:Xenopus tropicalis


Alignment Length:222 Identity:97/222 - (43%)
Similarity:140/222 - (63%) Gaps:4/222 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LEILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKAEAKASGRCLAAGILAPK 67
            |.::|||||.|:|.|.|.|:|.::||||.|.||||.|:.::|.:|...|.::..||..|||.||.
 Frog    20 LSLMKQGAEARVYRGRFLGKAAVVKERFPKAYRHPALDGKLTHRRTAQEVRSIVRCRKAGISAPV 84

  Fly    68 ILHSDLNTHKLYMEYFDAAKTAKQFIQETVSTQTEDEAKKCLLEFCTRIGEIIGKMHSNHIIHGD 132
            :...|..|:.:|:|..:.:.|.:..|   :|.|...:....|.....:||:::.:||...:||||
 Frog    85 VYFVDYVTNCIYLEDIEESTTVRDHI---ISMQQCGKEASNLCALADKIGQVLARMHDEDVIHGD 146

  Fly   133 LTTSNILINPKGGDYDVILIDFGLSHYNQATEDKGVDLYVLERALLSTHSEQPYIFEHVLAAYRT 197
            |||||:|:.|...|::::|||||||..:...|||||||||||:|.||||.....||..:|.:| :
 Frog   147 LTTSNMLLRPPCDDHNLVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTEEIFRALLQSY-S 210

  Fly   198 ACGKDEQAVLTKFEEVRARGRKRTMIG 224
            :..|....|:.|.:|||.|||||:|:|
 Frog   211 SNSKKSGPVIKKLDEVRLRGRKRSMVG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpkNP_647948.1 PKc_like 3..224 CDD:304357 96/220 (44%)
tp53rkXP_002933205.2 Bud32 20..237 CDD:226168 96/220 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6090
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6042
Inparanoid 1 1.050 185 1.000 Inparanoid score I3816
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1425238at2759
OrthoFinder 1 1.000 - - FOG0003198
OrthoInspector 1 1.000 - - oto104041
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R156
SonicParanoid 1 1.000 - - X2602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.