DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT13 and LamC

DIOPT Version :9

Sequence 1:NP_705694.3 Gene:KRT13 / 3860 HGNCID:6415 Length:458 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:412 Identity:123/412 - (29%)
Similarity:193/412 - (46%) Gaps:75/412 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   104 EKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERD--YSPYYKTIEELRDKI 166
            ||..:|:||||||.|::::|.||..|:.|   .::.:|.|...:.|..  .:.|.|.:...| |:
  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRL---TQELNLAQDTVNRETSNLKAVYEKELAAAR-KL 106

Human   167 LTATIENNRVILEIDNARLAADDFRLK------------YENELALRQSVEADING--------- 210
            |..|.: .:..||||..||..::..||            .||...|.::...::||         
  Fly   107 LDETAK-EKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADR 170

Human   211 ----------------LRRVLDEL-------TLSKTDLEMQIESLNEELAYMKKNHEEEMKEFS- 251
                            |||.||:|       ||::.|||.|.:||.||||:..:.|.:|:.|.. 
  Fly   171 KKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235

Human   252 ------NQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHTKSAELNKEVSTN 310
                  :::.|:::.:.:|    .|.:.|.|:|:|||.....||.:.|..:..:...| |..:..
  Fly   236 RRQIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNL-KAAANR 295

Human   311 TAMIQTSKTEITELRRT-LQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQL 374
            .|......||...|.|| :.||..:||:.....|||...:.|.|.....:.|:....|:|:||:|
  Fly   296 AAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAEL 360

Human   375 SELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKM----IGFPSSAGSVSPRSTSVTT 435
            ..:|.||..|.|||:.|:|||..|:.|||.|..||.|::.::    .|.|::...:|...:.:|.
  Fly   361 QRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTA 425

Human   436 TSSASVTTTSNASGRRTSDVRR 457
            ::       |:.|||.|...||
  Fly   426 SA-------SSRSGRVTPSGRR 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT13NP_705694.3 Head 1..103
Filament 103..415 CDD:306535 112/364 (31%)
Coil 1A 104..139 15/34 (44%)
Linker 1 140..158 4/19 (21%)
Coil 1B 159..250 37/134 (28%)
Linker 12 251..273 3/28 (11%)
Coil 2 274..412 50/138 (36%)
Tail 413..458 11/49 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..458 10/38 (26%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 112/364 (31%)
ATP-synt_B <67..>142 CDD:304375 21/79 (27%)
MreC <178..>224 CDD:302802 18/45 (40%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.