DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and DID2

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_012961.3 Gene:DID2 / 853906 SGDID:S000006435 Length:204 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:43/213 - (20%)
Similarity:96/213 - (45%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQL 67
            |.:|..|.|.|:.|::.:::.::..::..:.:|.:.|                |.|..||.|...
Yeast    11 NTLFQLKFTSKQLQKQANKASKEEKQETNKLKRALNE----------------NEDISRIYASNA 59

  Fly    68 VEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQA 132
            :..:.::.:....|.::.|:..:.:.......:|.:||...|.|.:..:.|..:.|...:.:|: 
Yeast    60 IRKKNERLQLLKLASRVDSVASRVQTAVTMRQVSASMGQVCKGMDKALQNMNLQQITMIMDKFE- 123

  Fly   133 ANMKMEMTDEMINDTLDDMLNESG---DEEESNAVVNKVLDEIGIEI--SGKMSSIPATGSSDFE 192
              .:.|..|..:|...|..:|...   |.::.:.:::||.||.|:|:  |.|:.::|...:.:..
Yeast   124 --QQFEDLDTSVNVYEDMGVNSDAMLVDNDKVDELMSKVADENGMELKQSAKLDNVPEIKAKEVN 186

  Fly   193 TSGKRTEKDIADQLAKLR 210
            ...::.:| :|.:|..||
Yeast   187 VDDEKEDK-LAQRLRALR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 32/172 (19%)
DID2NP_012961.3 Did4 21..204 CDD:227778 39/203 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.