DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and DID4

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_012924.2 Gene:DID4 / 853868 SGDID:S000001485 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:53/185 - (28%)
Similarity:108/185 - (58%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFNNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAK 65
            :|..:|||..|.:|:.::|.|:|.:..|::|||:||:|.:::||..||:::|..|...|.::.||
Yeast     3 LFEWVFGKNVTPQERLKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAAAKVQAK 67

  Fly    66 QLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQF 130
            .||..|....:......::|:|..:.:.:.::..::.:|......:..||:.|....:.....:|
Yeast    68 DLVRTRNYIQKFDNMKAQLQAISLRIQAVRSSDQMTRSMSEATGLLAGMNRTMNLPQLQRISMEF 132

  Fly   131 QAANMKMEMTDEMINDTLDDMLNESGDE-EESNAVVNKVLDEIGIEISGKMSSIP 184
            :..:..|....|.:::.:|:::.:..|| ||::.:|||||||||::::.::.|.|
Yeast   133 EKQSDLMGQRQEFMDEAIDNVMGDEVDEDEEADEIVNKVLDEIGVDLNSQLQSTP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 47/168 (28%)
DID4NP_012924.2 Did4 38..229 CDD:227778 39/150 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.