DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and VPS2.2

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_199269.1 Gene:VPS2.2 / 834483 AraportID:AT5G44560 Length:222 Species:Arabidopsis thaliana


Alignment Length:217 Identity:72/217 - (33%)
Similarity:122/217 - (56%) Gaps:8/217 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLV 68
            |||.||.|.|:..|.:.|.:..|||.||||...::.||::|..||::.|..||..|.:|||:|||
plant     2 NIFKKKTTPKDALRTSKREMAVATRGIEREITSLQLEEKRLVAEIKKTAKTGNEAATKILARQLV 66

  Fly    69 EIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAA 133
            .:|:|.:....:..:|:.:....:.:.|:.::|..|....|.|..|||.|.|....:.::.||..
plant    67 RLRQQITNLQGSRAQIRGVTTHTQALYASTSISSGMKGATKAMVAMNKQMAPTKQAKVIKDFQKQ 131

  Fly   134 NMKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIP--------ATGSSD 190
            :.:::||.||:::.:|:.|::...|||:..:.|:||||||:.::.::||.|        |...:.
plant   132 SAQLDMTIEMMSEAIDETLDKDEAEEETEDLTNQVLDEIGVGVASQLSSAPKGRIATKTAAPPAS 196

  Fly   191 FETSGKRTEKDIADQLAKLRSS 212
            ...:.|.:|....|:|.|..:|
plant   197 TAATNKNSESSEVDELEKRLAS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 57/175 (33%)
VPS2.2NP_199269.1 Snf7 17..184 CDD:419749 57/166 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 126 1.000 Domainoid score I1778
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 1 1.010 - - D1480977at2759
OrthoFinder 1 1.000 - - FOG0005657
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10476
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4058
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.