DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and VPS2.1

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_565336.1 Gene:VPS2.1 / 815211 AraportID:AT2G06530 Length:225 Species:Arabidopsis thaliana


Alignment Length:227 Identity:79/227 - (34%)
Similarity:129/227 - (56%) Gaps:21/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFNNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAK 65
            |.|:||||:.|..|..|||.|.|.|:.|:|||||:.::.:|:||..||::.|..|...|.:::||
plant     1 MMNSIFGKRKTPAELLRENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAKQGQMGAVKVMAK 65

  Fly    66 QLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQF 130
            .|:..|.|..:.|....::|.:..:.:.:.:..|:.|||....|.||:||:.|...::.:.:::|
plant    66 DLIRTRHQIEKFYKLKSQLQGVSLRIQTLKSTQAMGEAMKGVTKAMGQMNRQMNLPSLQKIMQEF 130

  Fly   131 QAANMKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIP----------- 184
            :..|.||||..|::.|.:||.|....:|||:..:|::|||||||:|:.::.:.|           
plant   131 ERQNEKMEMVSEVMGDAIDDALEGDEEEEETEDLVSQVLDEIGIDINQELVNAPSGAVAVPAAKN 195

  Fly   185 ------ATGSSDFETSGKRTEKDIADQLAKLR 210
                  |||:.|   || ..:.|:..:|..||
plant   196 KVVQAEATGAED---SG-GIDSDLQARLDNLR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 60/184 (33%)
VPS2.1NP_565336.1 Snf7 18..187 CDD:397437 60/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.