DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and Chmp2b

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_081155.1 Gene:Chmp2b / 68942 MGIID:1916192 Length:213 Species:Mus musculus


Alignment Length:205 Identity:104/205 - (50%)
Similarity:143/205 - (69%) Gaps:3/205 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRK 72
            ||.||.:..:|.:|.||...|.|.|:|..:|::|::|||||::.|..||.:|||:||||||.:||
Mouse     6 KKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRK 70

  Fly    73 QKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKM 137
            ||:||:|.:.|:.|:..|.|.|.:.:.::.||.||||||..:||.|.|:...:|::.||..||||
Mouse    71 QKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKM 135

  Fly   138 EMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIP-ATGSSDFETSGKRT--E 199
            |||:|||||||||:.:.|.|||||..:||:|||||||||||||:..| |..|....::.|.|  :
Mouse   136 EMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISD 200

  Fly   200 KDIADQLAKL 209
            ::|..||..|
Mouse   201 EEIERQLKAL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 92/168 (55%)
Chmp2bNP_081155.1 Snf7 16..185 CDD:397437 92/168 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..199 5/19 (26%)
MIT-interacting motif 201..211 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830715
Domainoid 1 1.000 184 1.000 Domainoid score I3408
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8534
Inparanoid 1 1.050 191 1.000 Inparanoid score I3866
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005657
OrthoInspector 1 1.000 - - oto94348
orthoMCL 1 0.900 - - OOG6_105602
Panther 1 1.100 - - LDO PTHR10476
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3454
SonicParanoid 1 1.000 - - X4058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.