DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and Chmp2b

DIOPT Version :10

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_081155.1 Gene:Chmp2b / 68942 MGIID:1916192 Length:213 Species:Mus musculus


Alignment Length:86 Identity:19/86 - (22%)
Similarity:37/86 - (43%) Gaps:14/86 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LHAGYFRISLSLCSQALLWKIMVHLHS-ELPSMAYYLLWYLALAT-QVSLCFLYAFKCIFLFDMV 103
            ||..::::...|  |.||..:..|... .|.:..|...|:|.|.| :..||.::....:.|.:  
Mouse   687 LHCKFYQLERLL--QELLPDLWSHFQELNLEAHMYASQWFLTLFTAKFPLCMVFHITDLLLCE-- 747

  Fly   104 KEEFSHYIGVNYLYAPSISCL 124
                    |:|.::..:::.|
Mouse   748 --------GLNIIFNVALALL 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:460896 19/86 (22%)
Chmp2bNP_081155.1 Snf7 16..185 CDD:460896
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..199
MIT-interacting motif 201..211
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.