DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and CHMP1B

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_065145.2 Gene:CHMP1B / 57132 HGNCID:24287 Length:199 Species:Homo sapiens


Alignment Length:197 Identity:41/197 - (20%)
Similarity:94/197 - (47%) Gaps:18/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAK-------QLVEIRKQKSRTYA 79
            :|:.|.:::.|..:|.::||:..:.:|::....||.:..||.|:       |.|...:..:|..|
Human    10 NLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDA 74

  Fly    80 AAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMI 144
            .|.::|:.....|       ::::|....|:|....|.|..|.|...:.:|:.....:::..:.:
Human    75 VAARVQTAVTMGK-------VTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQM 132

  Fly   145 NDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEKD-IADQLAK 208
            .||:......:..:.:.:.::.::.||.|::::   ..:|...:....||....|:| ::.:||:
Human   133 EDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLN---MELPQGQTGSVGTSVASAEQDELSQRLAR 194

  Fly   209 LR 210
            ||
Human   195 LR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 33/170 (19%)
CHMP1BNP_065145.2 Snf7 49..189 CDD:419749 28/149 (19%)
Interaction with IST1 132..156 2/23 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..199 9/30 (30%)
Interaction with SPAST. /evidence=ECO:0000269|PubMed:15537668 174..199 8/23 (35%)
Interaction with VTA1 180..199 6/17 (35%)
Interaction with VPS4A, MITD1 and STAMBP. /evidence=ECO:0000269|PubMed:19129480 180..196 4/15 (27%)
Interaction with VPS4B 183..199 6/14 (43%)
MIT-interacting motif 186..196 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.