Sequence 1: | NP_647947.1 | Gene: | CHMP2B / 38599 | FlyBaseID: | FBgn0035589 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065145.2 | Gene: | CHMP1B / 57132 | HGNCID: | 24287 | Length: | 199 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 41/197 - (20%) |
---|---|---|---|
Similarity: | 94/197 - (47%) | Gaps: | 18/197 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 SLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAK-------QLVEIRKQKSRTYA 79
Fly 80 AAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMI 144
Fly 145 NDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEKD-IADQLAK 208
Fly 209 LR 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CHMP2B | NP_647947.1 | Snf7 | 18..186 | CDD:281366 | 33/170 (19%) |
CHMP1B | NP_065145.2 | Snf7 | 49..189 | CDD:419749 | 28/149 (19%) |
Interaction with IST1 | 132..156 | 2/23 (9%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 167..199 | 9/30 (30%) | |||
Interaction with SPAST. /evidence=ECO:0000269|PubMed:15537668 | 174..199 | 8/23 (35%) | |||
Interaction with VTA1 | 180..199 | 6/17 (35%) | |||
Interaction with VPS4A, MITD1 and STAMBP. /evidence=ECO:0000269|PubMed:19129480 | 180..196 | 4/15 (27%) | |||
Interaction with VPS4B | 183..199 | 6/14 (43%) | |||
MIT-interacting motif | 186..196 | 3/9 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5491 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |