DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and chmp2bb

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_998069.1 Gene:chmp2bb / 405840 ZFINID:ZDB-GENE-040426-2539 Length:214 Species:Danio rerio


Alignment Length:206 Identity:97/206 - (47%)
Similarity:142/206 - (68%) Gaps:4/206 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRK 72
            ||.||.:..:|.::.||...|.|.|:|..:|::|::||:||::.|..||.|||::||||||::||
Zfish     6 KKKTVDDVIKEQNKELRGTQRQIARDRTALEKQEKQLEMEIKKMAKTGNRDACKVLAKQLVQVRK 70

  Fly    73 QKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKM 137
            ||:||||.:.|:.|:..|.|.|.:.:.::.||.||.|||..:||.|.|:...:|::.||....||
Zfish    71 QKTRTYAVSSKVTSMSTQTKLMNSQMKMAGAMATTTKTMQAVNKKMDPKKTMQTLQNFQKETAKM 135

  Fly   138 EMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPA----TGSSDFETSGKRT 198
            :||:||:|||||::..:|||||||..:||:|||||||||||||:..|:    |.|:....:...:
Zfish   136 DMTEEMMNDTLDEIFEDSGDEEESQDIVNQVLDEIGIEISGKMAHAPSAARKTPSAATAKADGIS 200

  Fly   199 EKDIADQLAKL 209
            ::||..||..|
Zfish   201 DEDIERQLKAL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 86/171 (50%)
chmp2bbNP_998069.1 Snf7 16..185 CDD:281366 86/168 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..199 4/20 (20%)
MIT-interacting motif 202..212 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573455
Domainoid 1 1.000 180 1.000 Domainoid score I3459
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8534
Inparanoid 1 1.050 188 1.000 Inparanoid score I3893
OMA 1 1.010 - - QHG53529
OrthoDB 1 1.010 - - D1480977at2759
OrthoFinder 1 1.000 - - FOG0005657
OrthoInspector 1 1.000 - - otm25784
orthoMCL 1 0.900 - - OOG6_105602
Panther 1 1.100 - - O PTHR10476
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3454
SonicParanoid 1 1.000 - - X4058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.