DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and Chmp1a

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001076782.1 Gene:Chmp1a / 365024 RGDID:1311083 Length:196 Species:Rattus norvegicus


Alignment Length:215 Identity:43/215 - (20%)
Similarity:99/215 - (46%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFNNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRR----NAAAGNNDACR 61
            |.:.:|..|.|.|:.    ::..:||.:|.:.|:.|:::..::..:|..|    ||....|:...
  Rat     1 MDDTLFQLKFTAKQL----EKLAKKAEKDSKAEQAKVKKALQQKNVECARVYAENAIRKKNEGVN 61

  Fly    62 ILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGET 126
            .|        :..||..|.|.|:|: ....|.:..|      |....|.:.:....|..:.:...
  Rat    62 WL--------RMASRVDAVASKVQT-AVTMKGVTKN------MAQVTKALDKALSAMDLQKVSAV 111

  Fly   127 VRQFQAANMKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDF 191
            :.:|:.....:::...::.|::......:..:|:.::::.::.:|.|:|:..::|.:|...|:..
  Rat   112 MDRFEQQVQNLDVHTSVMEDSVSSATTLTTPQEQVDSLIVQIAEENGLEVLDQLSQLPEGASAVG 176

  Fly   192 ETSGKRTEKDIADQLAKLRS 211
            |:|.:..|..::.:||.||:
  Rat   177 ESSVRSQEDQLSRRLAALRN 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 30/171 (18%)
Chmp1aNP_001076782.1 Snf7 12..195 CDD:419749 37/201 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.