DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and Chmp2b

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_343996.5 Gene:Chmp2b / 363720 RGDID:1306781 Length:213 Species:Rattus norvegicus


Alignment Length:205 Identity:104/205 - (50%)
Similarity:143/205 - (69%) Gaps:3/205 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRK 72
            ||.||.:..:|.:|.||...|.|.|:|..:|::|::|||||::.|..||.:|||:||||||.:||
  Rat     6 KKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRK 70

  Fly    73 QKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKM 137
            ||:||:|.:.|:.|:..|.|.|.:.:.::.||.||||||..:||.|.|:...:|::.||..||||
  Rat    71 QKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKM 135

  Fly   138 EMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIP-ATGSSDFETSGKRT--E 199
            |||:|||||||||:.:.|.|||||..:||:|||||||||||||:..| |..|....::.|.|  :
  Rat   136 EMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISD 200

  Fly   200 KDIADQLAKL 209
            ::|..||..|
  Rat   201 EEIERQLKAL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 92/168 (55%)
Chmp2bXP_343996.5 Snf7 16..185 CDD:397437 92/168 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334427
Domainoid 1 1.000 184 1.000 Domainoid score I3327
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8534
Inparanoid 1 1.050 191 1.000 Inparanoid score I3786
OMA 1 1.010 - - QHG53529
OrthoDB 1 1.010 - - D1480977at2759
OrthoFinder 1 1.000 - - FOG0005657
OrthoInspector 1 1.000 - - oto97869
orthoMCL 1 0.900 - - OOG6_105602
Panther 1 1.100 - - LDO PTHR10476
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.