DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and RGD1566265

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001128061.1 Gene:RGD1566265 / 363487 RGDID:1566265 Length:199 Species:Rattus norvegicus


Alignment Length:202 Identity:41/202 - (20%)
Similarity:98/202 - (48%) Gaps:28/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAK-------QLVEIRKQKSRTYA 79
            :|:.|.:::.|..:|.::||:..:.:|::....||.:..||.|:       |.:...:..:|..|
  Rat    10 NLKFAAKELNRNAKKCDKEEKAEKAKIKKAIQKGNTEVARIHAENAIRQKNQAINFLRMSARVDA 74

  Fly    80 AAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMI 144
            .|.::|:.....|       ::::|....|:|....:.|..|.|...:.:|:.....:::..:.:
  Rat    75 VAARVQTAVTMGK-------VTKSMAGVVKSMDATLRSMNLEKISALMDKFEHQFETLDVQTQQM 132

  Fly   145 NDTLDDMLNESGDEEESNAVVNKVLDEIGIEIS-----GKMSSIPATGSSDFETSGKRTEKD-IA 203
            .||:......:..:.:.:.::.::.||.|::::     |:..|:.|:.:|        ||:| ::
  Rat   133 EDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGASVAS--------TEQDELS 189

  Fly   204 DQLAKLR 210
            .:||:||
  Rat   190 QRLARLR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 32/175 (18%)
RGD1566265NP_001128061.1 Snf7 49..>165 CDD:419749 21/122 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.