Sequence 1: | NP_647947.1 | Gene: | CHMP2B / 38599 | FlyBaseID: | FBgn0035589 | Length: | 212 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956308.1 | Gene: | chmp1b / 336426 | ZFINID: | ZDB-GENE-030131-8370 | Length: | 199 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 40/197 - (20%) |
---|---|---|---|
Similarity: | 95/197 - (48%) | Gaps: | 18/197 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 SLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAK-------QLVEIRKQKSRTYA 79
Fly 80 AAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMI 144
Fly 145 NDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEKD-IADQLAK 208
Fly 209 LR 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CHMP2B | NP_647947.1 | Snf7 | 18..186 | CDD:281366 | 31/170 (18%) |
chmp1b | NP_956308.1 | Snf7 | 40..189 | CDD:304451 | 29/158 (18%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 167..199 | 10/30 (33%) | |||
MIT-interacting motif | 186..196 | 4/9 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |