DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and chmp1b

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_956308.1 Gene:chmp1b / 336426 ZFINID:ZDB-GENE-030131-8370 Length:199 Species:Danio rerio


Alignment Length:197 Identity:40/197 - (20%)
Similarity:95/197 - (48%) Gaps:18/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAK-------QLVEIRKQKSRTYA 79
            :|:.|.::::|..:|.::||:..::::::....||.:..||.|:       |.|...:..:|..|
Zfish    10 NLKFAAKELQRNSKKCDKEEKAEKVKVKKAIQKGNMEVARIHAENAIRQKNQSVNFLRMSARVDA 74

  Fly    80 AAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMI 144
            .|.::|:....|:       ::::|....|.|....|.|..|.|...:.:|:.....:::....:
Zfish    75 VAARVQTAVTMNQ-------VTKSMAGVVKGMDATLKSMNLEKISGLMEKFERQFETLDVQTAQM 132

  Fly   145 NDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEKD-IADQLAK 208
            .|::......:..:.:.:.::.::.||.|::::   ..:|...:....||....|:| ::.:|||
Zfish   133 EDSMSSTTTLTTPQGQVDTLMMEMADEAGLDLN---MELPQGQTGSVGTSVASAEQDELSQRLAK 194

  Fly   209 LR 210
            ||
Zfish   195 LR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 31/170 (18%)
chmp1bNP_956308.1 Snf7 40..189 CDD:304451 29/158 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..199 10/30 (33%)
MIT-interacting motif 186..196 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.