DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and Chmp3

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_758834.1 Gene:Chmp3 / 282834 RGDID:708556 Length:223 Species:Rattus norvegicus


Alignment Length:222 Identity:61/222 - (27%)
Similarity:109/222 - (49%) Gaps:16/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFGK---KPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQ 66
            :|||   ||. ||...|....:||..|.::|:.|.::.||.|::..::..|..|..:.|.:|||:
  Rat     3 LFGKTQEKPP-KELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKE 66

  Fly    67 LVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQ 131
            ::..||..|:.||:...:.|:....||..|.:.::.::..:.:.|..|..:::...|..|:|:..
  Rat    67 MIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELS 131

  Fly   132 AANMKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSS---------IPATG 187
            ...||..:.:||:.||.:.|.::...||.:...::::|.||.....||..|         .||..
  Rat   132 KEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDALPEPEPAGA 196

  Fly   188 SSDFETSGKRTEKDI---ADQLAKLRS 211
            .:..|...:..|:|:   ..:||.|||
  Rat   197 MAASEGDEEDDEEDLEAMQSRLATLRS 223

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 45/176 (26%)
Chmp3NP_758834.1 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 2..113 32/110 (29%)
Snf7 18..187 CDD:281366 44/168 (26%)
Important for autoinhibitory function. /evidence=ECO:0000250 59..64 1/4 (25%)
Interaction with VPS4A. /evidence=ECO:0000250 151..223 17/71 (24%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 151..221 16/69 (23%)