DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and CHMP2B

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_011531878.1 Gene:CHMP2B / 25978 HGNCID:24537 Length:229 Species:Homo sapiens


Alignment Length:201 Identity:102/201 - (50%)
Similarity:140/201 - (69%) Gaps:7/201 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRKQKSR 76
            :|||.||    ||...|.|.|:|..:|::|::|||||::.|..||.:||::||||||.:||||:|
Human    30 IKEQNRE----LRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTR 90

  Fly    77 TYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTD 141
            |:|.:.|:.|:..|.|.|.:.:.::.||.||||||..:||.|.|:...:|::.||..|||||||:
Human    91 TFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTE 155

  Fly   142 EMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIP-ATGSSDFETSGKRT--EKDIA 203
            |||||||||:.:.|.|||||..:||:|||||||||||||:..| |..|....::.|.|  :::|.
Human   156 EMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIE 220

  Fly   204 DQLAKL 209
            .||..|
Human   221 RQLKAL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 90/168 (54%)
CHMP2BXP_011531878.1 Snf7 32..201 CDD:281366 92/168 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140741
Domainoid 1 1.000 183 1.000 Domainoid score I3447
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8534
Inparanoid 1 1.050 190 1.000 Inparanoid score I3892
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 1 1.010 - - D1480977at2759
OrthoFinder 1 1.000 - - FOG0005657
OrthoInspector 1 1.000 - - oto90766
orthoMCL 1 0.900 - - OOG6_105602
Panther 1 1.100 - - LDO PTHR10476
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3454
SonicParanoid 1 1.000 - - X4058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.