DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and did4

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_593871.3 Gene:did4 / 2543521 PomBaseID:SPAC4F8.01 Length:210 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:72/207 - (34%)
Similarity:119/207 - (57%) Gaps:7/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVE 69
            :||...:.:||.|.:.|||.:|.|:::|||.|:::.||.|..||:.:|.|||..|.||.|:.|:.
pombe     7 LFGGGKSPQEQLRAHQRSLGRAERELDRERTKLDQRERALIQEIKGSAKAGNTGAARIQARDLMR 71

  Fly    70 IRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAAN 134
            :|..:.:...|..::|:|..:.:.|..:..:.::|....:.:..|||.|...|:....:||:..|
pombe    72 LRNSRKKMMNAKTQLQAISLRLQTMRTSEQMMQSMRGATRLLTGMNKSMNIPAMARITQQFEREN 136

  Fly   135 MKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTE 199
            ..||...|||::.:||.|.|. ||||::.:|||||||||:::|   ..:|...:........:||
pombe   137 EIMEQRQEMIDENMDDALEED-DEEEADELVNKVLDEIGVDLS---QGLPDAATQIGTVPELKTE 197

  Fly   200 KDI---ADQLAK 208
            .::   .|:|||
pombe   198 DNLQARLDELAK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 61/167 (37%)
did4NP_593871.3 Snf7 22..186 CDD:304451 61/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.