DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and vps-2

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_496717.1 Gene:vps-2 / 174908 WormBaseID:WBGene00012903 Length:237 Species:Caenorhabditis elegans


Alignment Length:193 Identity:61/193 - (31%)
Similarity:116/193 - (60%) Gaps:1/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVE 69
            :||::.|..|..|:|.|:|.||.|:::|||.:||.:|:|:..:|:..|.....|:.:::||.||.
 Worm     4 LFGRRKTPAELLRQNQRALNKAIRELDRERARMEAQEKKVIADIKNMAKKNQMDSVKVMAKDLVR 68

  Fly    70 IRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAAN 134
            .|:...:.......||::..:.:.:.:..|::.||....|.|..||:.:....|.:.:.:|:..:
 Worm    69 TRRYIKKFIVMKANIQAVSLKVQTLKSQDAMASAMKGVTKAMQSMNRQLNLPQIQKIMMEFEKQS 133

  Fly   135 MKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKR 197
            ..|:|.:|::.|.:||.|.::|||||::.:||:||||:||::..:|:.:| :.:......|:|
 Worm   134 EIMDMKEEVMGDAIDDALGDAGDEEETDQIVNQVLDELGIQMGEEMAGLP-SAAGGLNAGGER 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 54/167 (32%)
vps-2NP_496717.1 Snf7 17..186 CDD:281366 54/169 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.