DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and did-2

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_490974.1 Gene:did-2 / 171801 WormBaseID:WBGene00017735 Length:205 Species:Caenorhabditis elegans


Alignment Length:204 Identity:44/204 - (21%)
Similarity:98/204 - (48%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRKATRDIERERRKMEEEER----KLELEIRRNAAAGNNDACRILAK-------QLVEIRKQKSR 76
            |:.|.:.:|:..::.|::|:    ||...|::    ||.:..::.|:       :.|...|..:|
 Worm    17 LKFAAKQLEKNAQRCEKDEKVEKDKLTAAIKK----GNKEVAQVHAENAIRKKNEAVNYIKMAAR 77

  Fly    77 TYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTD 141
            ..|.|.::|:...|.:       ::.:|....|.|....|.|..|.:.:.:.:|:.....:::|.
 Worm    78 IDAVAARVQTAATQKR-------VTASMSGVVKAMESAMKSMNLEKVQQLMDRFERDFEDLDVTT 135

  Fly   142 EMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKM-SSIPA---TGSSDFETSGKRTEKDI 202
            :.:..|:|.....:..:.:.:|::.:..|:.|||::.:: |::|.   ||     |.....:||:
 Worm   136 KTMEKTMDGTTVLNAPKSQVDALIAEAADKAGIELNQELPSNVPTALPTG-----TQAVSEDKDL 195

  Fly   203 ADQLAKLRS 211
            .::||.||:
 Worm   196 TERLAALRN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 35/177 (20%)
did-2NP_490974.1 Snf7 16..181 CDD:304451 35/174 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.