DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP2B and RNF103-CHMP3

DIOPT Version :9

Sequence 1:NP_647947.1 Gene:CHMP2B / 38599 FlyBaseID:FBgn0035589 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001185883.1 Gene:RNF103-CHMP3 / 100526767 HGNCID:38847 Length:251 Species:Homo sapiens


Alignment Length:208 Identity:56/208 - (26%)
Similarity:104/208 - (50%) Gaps:11/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRKQKSRTYA 79
            |..|....:||..|.::|:.|.::.||.|::..::..|..|..|.|.:|||:::..||..|:.||
Human    44 QVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYA 108

  Fly    80 AAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMI 144
            :...:.|:....||..|.:.::.::..:.:.|..|..:::...|..|:|:.....||..:.:||:
Human   109 SKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEML 173

  Fly   145 NDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSS-----IP------ATGSSDFETSGKRT 198
            .||.:.|.::...|||:...::::|.||.....||..|     :|      |..:|:.|...:..
Human   174 EDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEA 238

  Fly   199 EKDIADQLAKLRS 211
            .:.:..:||.|||
Human   239 LEAMQSRLATLRS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP2BNP_647947.1 Snf7 18..186 CDD:281366 47/178 (26%)
RNF103-CHMP3NP_001185883.1 Snf7 47..216 CDD:281366 46/168 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.