DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and YMR226C

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:73/266 - (27%)
Similarity:124/266 - (46%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SQSSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAE----DGAAVVISSRKQKNVDSALAELRKL 118
            ||...|.  :|||.|..::|.::.|||.|.|....|    |...::.:.|.:|     |.||:|.
Yeast     2 SQGRKAA--ERLAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEK-----LEELKKT 59

  Fly   119 ------NLNVHGLKCHVSEPEDRKQLFEETISKFGKLNILVSNAAT---NPAVGGVLECDEKVWD 174
                  |..||..:..:::.|..|...|....:|..::|||:||..   :..||.:  ..|.:.|
Yeast    60 IDQEFPNAKVHVAQLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQI--ATEDIQD 122

  Fly   175 KIFDVNVKSSYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDL 239
             :||.||.:...:.:..||:.:.:.:..||.:.||||.||:.....|..||.|:...|.:..|:|
Yeast   123 -VFDTNVTALINITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKEL 186

  Fly   240 APEGIRVNCLAPGVIRTKFSKALY--ENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYI 302
            ....|||..:|||::.|:||...|  ..|.|........|:    .::::|.::.:..|.....:
Yeast   187 INTKIRVILIAPGLVETEFSLVRYRGNEEQAKNVYKDTTPL----MADDVADLIVYATSRKQNTV 247

  Fly   303 TGESIV 308
            ..::::
Yeast   248 IADTLI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 70/257 (27%)
fabG 67..316 CDD:235975 70/257 (27%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 67/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772507 Normalized mean entropy S1637
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.