DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and IRC24

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:64/203 - (31%)
Similarity:95/203 - (46%) Gaps:13/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GKVAVVTASTDGIGFAIAKR-LAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPED 134
            |||.::|.::.|||..:.|. :.||...:|....:   .::.|..|:: ..........|.:..|
Yeast     2 GKVILITGASRGIGLQLVKTVIEEDDECIVYGVAR---TEAGLQSLQR-EYGADKFVYRVLDITD 62

  Fly   135 RKQ---LFEETISKFGKLNILVSNAATNPAVGGV----LECDEKVWDKIFDVNVKSSYLLAKEAL 192
            |.:   |.||...|.|||:.:|:||.....|..:    .|.|.|.|:::||||..|...|....|
Yeast    63 RSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCL 127

  Fly   193 PLLRQQK-NSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRT 256
            |||:... ..:||||||.|....:....||..||.||.......|.:...:.:|..|:||||:.|
Yeast   128 PLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDT 192

  Fly   257 KFSKALYE 264
            :..|.:.|
Yeast   193 QMQKDIRE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 64/203 (32%)
fabG 67..316 CDD:235975 64/203 (32%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 62/201 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341301
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2055
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.