DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and NRE1

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:71/220 - (32%)
Similarity:100/220 - (45%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GKVAVVTASTDGIGFAIAKRL-AEDGAAVVISSRKQKNVDSALAELRKLN-------LNVHGLKC 127
            |||.:||..:.|||.:|...| :.|...||....:.:      |.|:||.       ..|.|   
Yeast     2 GKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSE------APLKKLKEKYGDRFFYVVG--- 57

  Fly   128 HVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEAL 192
            .::|....|||....:...||::.||:||.....|..|.|.|...|.|::|:|..|...|...||
Yeast    58 DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIAL 122

  Fly   193 PLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCL--APGVIR 255
            |.|: :.|.::|||||.|....|...|||..||.||    ...|..||.|..:|..:  |||::.
Yeast   123 PELK-KTNGNVVFVSSDACNMYFSSWGAYGSSKAAL----NHFAMTLANEERQVKAIAVAPGIVD 182

  Fly   256 TKFSKALYENESANEAALSKIPMGR 280
            |.....:.||...:..:..::.|.|
Yeast   183 TDMQVNIRENVGPSSMSAEQLKMFR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 71/220 (32%)
fabG 67..316 CDD:235975 71/220 (32%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 69/218 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.