DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and OAR1

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012868.1 Gene:OAR1 / 853810 SGDID:S000001538 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:66/274 - (24%)
Similarity:112/274 - (40%) Gaps:51/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VAVVTASTDGIGFAIAKRLAEDG-AAVVISSRKQK---------NVDSALAELRKLNLNV----- 122
            ||:||.:|.|||.||.::|.:.| :.:::.|.|:.         .:.|.|:..|:..:.:     
Yeast     6 VAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQCAIAIDFKKW 70

  Fly   123 -HGLKCH----VSEPEDR---KQLFEETISKFGK---------LNILVSNAATNPAVGGVLECDE 170
             |.|...    :...:||   ||.:........|         :|:|::.|........|.....
Yeast    71 PHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQESLSVRTTAS 135

  Fly   171 KVWDKIFDVNVKS---------SYLLAKEAL--PLLRQQKNSSIVFVSSIAGYDAFELLG--AYS 222
            ::.| |.:||..|         .|::..:..  .|..|....:||.:|||......::.|  .||
Yeast   136 QIQD-IMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVPGTSVYS 199

  Fly   223 VSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTS--E 285
            .||.||...|:..|.::.|..||...::||:::   ...:.:|.......:.:..:|..|||  .
Yeast   200 ASKAALSRFTEVLAAEMEPRNIRCFTISPGLVK---GTDMIQNLPVEAKEMLERTIGASGTSAPA 261

  Fly   286 EMAGVVSFLVSEDA 299
            |:|..|..|.|..|
Yeast   262 EIAEEVWSLYSRTA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 66/274 (24%)
fabG 67..316 CDD:235975 66/274 (24%)
OAR1NP_012868.1 SDR_c 7..275 CDD:212491 64/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.