DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and AT1G62610

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001185294.1 Gene:AT1G62610 / 842558 AraportID:AT1G62610 Length:282 Species:Arabidopsis thaliana


Alignment Length:271 Identity:76/271 - (28%)
Similarity:139/271 - (51%) Gaps:14/271 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SQSSTAGTMKR------LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELR 116
            |...|...:|:      |..||.:||.::.|||..|...|.:.|..:|.::|:...::|..:|:.
plant     2 SNHQTKQVLKQLEPWCELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEIN 66

  Fly   117 K---LNLNVHGLKCHVSEPEDR-KQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIF 177
            .   :.:....|:..||...|. ::..:|....||.:::|::||.....|...|:..::.|||:|
plant    67 SFGAIGVQAAALELDVSSDADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSLDLSKEEWDKVF 131

  Fly   178 DVNVKSSYLLAKEALPLLRQQK-NSSIVFVSSIAGYDAFELLG--AYSVSKTALIGLTKAAAKDL 239
            ..|:..|:|::|....|:|..| ..|::.||||:|.....|.|  ||:.||..:..:|:..|.:|
plant   132 RTNLTGSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL 196

  Fly   240 APEGIRVNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEE-MAGVVSFLVSEDAGYIT 303
            |...||||.:|||:.|::.::.|::.|...:.....:|:....|.:. :..:|.:|:.:.:.|:|
plant   197 AVYKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDSSQYVT 261

  Fly   304 GESIVAGGGMT 314
            |.:.:...|.|
plant   262 GNTYIVDSGAT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 74/262 (28%)
fabG 67..316 CDD:235975 74/262 (28%)
AT1G62610NP_001185294.1 fabG 19..273 CDD:235546 73/254 (29%)
SDR_c 24..268 CDD:212491 68/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.