DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and AT1G54870

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001322466.1 Gene:AT1G54870 / 841926 AraportID:AT1G54870 Length:337 Species:Arabidopsis thaliana


Alignment Length:332 Identity:91/332 - (27%)
Similarity:153/332 - (46%) Gaps:49/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ASAVSGSGQSSSFDQNSNNYSRKL-----VGPNLNQCHKRLSSSSQ------------------- 59
            :|.|..|..:.||.|..||..:.|     :.|.:  |.:.::|..|                   
plant    12 SSRVLSSNVTFSFSQIPNNTKKPLLEKRRLSPRV--CLRAMASEKQKQHAQPGKEHVMESSPQFS 74

  Fly    60 SSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVV---ISSRKQKNVDSALAELRKLNLN 121
            ||......:|.||||::|....|||.|:....|.:||.|.   :..:::|:....|..|:::..:
plant    75 SSDYQPSNKLRGKVALITGGDSGIGRAVGYCFASEGATVAFTYVKGQEEKDAQETLQMLKEVKTS 139

  Fly   122 VHGLKCHVSEP----------EDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKI 176
                  ...||          |:.|::.:|.::.||::::|::|||.......:.|.||...:::
plant   140 ------DSKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVLINNAAEQYESSTIEEIDEPRLERV 198

  Fly   177 FDVNVKSSYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAP 241
            |..|:.|.:.|.:.||..:::  .|||:..:|:..|.....|..|:.:|.|::..|:..|..||.
plant   199 FRTNIFSYFFLTRHALKHMKE--GSSIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAE 261

  Fly   242 EGIRVNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLV-SEDAGYITGE 305
            :|||||.:|||.|.|....|.:..|...... |::||.|.|...|:|....||. :..:.|.||:
plant   262 KGIRVNGVAPGPIWTPLIPASFNEEKIKNFG-SEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQ 325

  Fly   306 SIVAGGG 312
            .:...||
plant   326 VLHPNGG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 76/260 (29%)
fabG 67..316 CDD:235975 76/260 (29%)
AT1G54870NP_001322466.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.