DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhrs4 and AT1G36580

DIOPT Version :10

Sequence 1:NP_647946.1 Gene:Dhrs4 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_174871.5 Gene:AT1G36580 / 840566 AraportID:AT1G36580 Length:195 Species:Arabidopsis thaliana


Alignment Length:100 Identity:20/100 - (20%)
Similarity:42/100 - (42%) Gaps:20/100 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SRKQKNVDSALAELRKLN-------------LNVHGLKCHVSEPEDRKQLFEETISKFGKLNILV 153
            |...|:.|.||.:..||.             :|..|:..::.:.:.:|::  .|.:....::|..
plant    98 SLDSKSADDALEKEDKLRSAFDRVQALDETMVNQKGILAYIEKKKKKKRM--ATSACVPTMSITW 160

  Fly   154 SNAATNP--AVGGVLECDE---KVWDKIFDVNVKS 183
            ..:.:||  ..|.:|..|:   .||..::.|..::
plant   161 VKSPSNPRRRRGSMLAKDDGNSTVWFVVYPVEKRA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhrs4NP_647946.1 Rossmann-fold NAD(P)(+)-binding proteins 67..317 CDD:473865 20/99 (20%)
AT1G36580NP_174871.5 Rossmann-fold NAD(P)(+)-binding proteins <1..35 CDD:473865
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.