DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and AT5G06060

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_196225.1 Gene:AT5G06060 / 830493 AraportID:AT5G06060 Length:264 Species:Arabidopsis thaliana


Alignment Length:256 Identity:101/256 - (39%)
Similarity:146/256 - (57%) Gaps:10/256 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TMKR--LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKC 127
            |.||  ||||.|:||..|.|||.|:.:.||:.||.|...||.|:.:::.|.:.:...|.|.|..|
plant     3 TDKRWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNACLNDWKANGLVVSGSVC 67

  Fly   128 HVSEPEDRKQLFEETISKF-GKLNILVSNAATN---PAVGGVLECDEKVWDKIFDVNVKSSYLLA 188
            ..|..:.|::|.:|..|.| ||||||::|..||   |.|    |...:.:.||...|::|::.|:
plant    68 DASVRDQREKLIQEASSAFSGKLNILINNVGTNVRKPTV----EYSSEEYAKIMSTNLESAFHLS 128

  Fly   189 KEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGV 253
            :.|.|||:.....||||:||:||.........|..:|.||..||:..|.:.|.:.||.||:||..
plant   129 QIAHPLLKASGVGSIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIRTNCVAPWY 193

  Fly   254 IRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMT 314
            |:|...:.|.|.:...||.:|:.|:||:|..||::.:|:||....:.||||:.|...||.|
plant   194 IKTSLVETLLEKKEFVEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYITGQVISVDGGFT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 100/254 (39%)
fabG 67..316 CDD:235975 100/254 (39%)
AT5G06060NP_196225.1 TR_SDR_c 6..256 CDD:187590 99/253 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.