DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and AT2G29360

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_180497.1 Gene:AT2G29360 / 817485 AraportID:AT2G29360 Length:271 Species:Arabidopsis thaliana


Alignment Length:252 Identity:84/252 - (33%)
Similarity:127/252 - (50%) Gaps:12/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPE 133
            |.|..|:||..:.|||.|:.:.||..||.:...:|.:..:..:|.:.:.....|....|.||..:
plant    16 LVGMTALVTGGSKGIGEAVVEELATLGARIHTCARDETQLQESLRKWQAKGFQVTTSVCDVSSRD 80

  Fly   134 DRKQLFEETISKF-GKLNILVSNAAT---NPAVGGVLECDEKVWDKIFDV--NVKSSYLLAKEAL 192
            .|::|.|...:.| |||||||:|..|   .|.:....|      |..|.:  |::|::.|::.|.
plant    81 KREKLMETVSTIFEGKLNILVNNVGTCIVKPTLQHTAE------DFSFTMATNLESAFHLSQLAH 139

  Fly   193 PLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTK 257
            |||:...:.|||.:||::|.........|.|||.|:..|.:..|.:.|.:.||.|.:.|..|.|.
plant   140 PLLKASGSGSIVLISSVSGVVHVNGASIYGVSKGAMNQLGRNLACEWASDNIRTNSVCPWFIETP 204

  Fly   258 FSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMT 314
            .......||...:...|:.||||:|...|::.:|:||....|.||||::|...||.|
plant   205 LVTESLSNEEFRKEVESRPPMGRVGEVNEVSSLVAFLCLPAASYITGQTICVDGGFT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 84/252 (33%)
fabG 67..316 CDD:235975 84/252 (33%)
AT2G29360NP_180497.1 NADB_Rossmann 13..263 CDD:419666 84/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.