DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and TRI

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_180494.1 Gene:TRI / 817482 AraportID:AT2G29330 Length:260 Species:Arabidopsis thaliana


Alignment Length:250 Identity:88/250 - (35%)
Similarity:133/250 - (53%) Gaps:8/250 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPE 133
            |.|..|:||....|||.||.:.||..||.:.:....:..::.:|:|..|....|.|..|..|...
plant     7 LQGLTALVTGGASGIGHAIVEELAGFGAKIHVCDISKTLLNQSLSEWEKKGFQVSGSVCDASNRL 71

  Fly   134 DRKQLFEETISKF-GKLNILVSNAA---TNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPL 194
            :|:.|.:...:.| |||||||:|..   |.|.:    |.:.:.:..:...|::|:|.|::.:.||
plant    72 ERETLMQTVTTIFDGKLNILVNNVGTIRTKPTI----EYEAEDFSFLISTNLESAYHLSQLSHPL 132

  Fly   195 LRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFS 259
            |:...|..|.|:||.||..:|:....|.::|.||..|.:..|.:.|.:|||.|.:||..|.|..:
plant   133 LKASGNGIITFISSAAGIVSFDAASIYGLTKGALNQLARNLACEWAKDGIRANAVAPNFITTALA 197

  Fly   260 KALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMT 314
            |...|:...||...|:.|:||.|...|:|.:|:||....|.||||::|...||:|
plant   198 KPFLEDAGFNEILSSRTPLGRAGEPREVASLVAFLCLPAASYITGQTICVDGGLT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 87/249 (35%)
fabG 67..316 CDD:235975 87/249 (35%)
TRINP_180494.1 NADB_Rossmann 4..254 CDD:389744 87/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.