DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and HSD17B8

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_055049.1 Gene:HSD17B8 / 7923 HGNCID:3554 Length:261 Species:Homo sapiens


Alignment Length:259 Identity:87/259 - (33%)
Similarity:129/259 - (49%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLK------ 126
            ||...:|:||.:..|||.|::.|||.:||.|...     ::|.|.|:.....|...|.|      
Human     8 RLRSALALVTGAGSGIGRAVSVRLAGEGATVAAC-----DLDRAAAQETVRLLGGPGSKEGPPRG 67

  Fly   127 ------CHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSY 185
                  ..|||....:.|.|:..:.|.:...:|.:.|.......:|...|..|||:..||:|.::
Human    68 NHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTF 132

  Fly   186 LLAKEAL-PLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCL 249
            |:.:.|. .|:......||:.:|||.|.........|:.||..:||||:.||::|...|||.|.:
Human   133 LVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSV 197

  Fly   250 APGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGM 313
            .||.|.|..::.:  .:...:.....||||.||..|::|.||:||.|||:|||||.|:...||:
Human   198 LPGFIATPMTQKV--PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 87/259 (34%)
fabG 67..316 CDD:235975 87/259 (34%)
HSD17B8NP_055049.1 BKR_SDR_c 13..260 CDD:187594 85/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.