DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001178040.1 Gene:Hsd17b14 / 691018 RGDID:1588673 Length:270 Species:Rattus norvegicus


Alignment Length:249 Identity:81/249 - (32%)
Similarity:125/249 - (50%) Gaps:10/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEP 132
            |.:|||.|||..:.|||.||.:...:.||.||...:.:....:...||    |....:...|::.
  Rat     6 RYSGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDEAGGRAVEQEL----LGTVFIPGDVTQE 66

  Fly   133 EDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQ 197
            .|.:.|..||:|:||.|:.:|:||..:|......|...:.:.::.:.|:..:|.|.|.|||.||:
  Rat    67 GDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEENLLGAYTLIKLALPHLRK 131

  Fly   198 QKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFSKAL 262
            .| .:|:.:||:.|.........|..:|.|:..:|||.|.|.:..|:||||::||.|.|...:.|
  Rat   132 SK-GNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRYGVRVNCISPGNIWTPLWQEL 195

  Fly   263 YENESANEAALSK----IPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312
            ....|...|.:.:    .|:||:|...|:.....||.|| |.:.||..:...||
  Rat   196 AAATSDPRATILEGTLAQPLGRMGQPAEVGAAAVFLASE-ATFCTGLELFMTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 81/249 (33%)
fabG 67..316 CDD:235975 81/249 (33%)
Hsd17b14NP_001178040.1 NADB_Rossmann 1..256 CDD:419666 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.