DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Decr1

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_080448.1 Gene:Decr1 / 67460 MGIID:1914710 Length:335 Species:Mus musculus


Alignment Length:257 Identity:77/257 - (29%)
Similarity:128/257 - (49%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVD--SALAE--LRKLNLNVHGLKCHVSE 131
            ||||.:|....|:|.|:...|:..||..||:||   |:|  .|.||  ..|....||.::|.|.:
Mouse    59 GKVAFITGGGTGLGKAMTTFLSTLGAQCVIASR---NIDVLKATAEEISSKTGNKVHAIRCDVRD 120

  Fly   132 PEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKV----WDKIFDVNVK-SSYLLAKEA 191
            |:.......|.|...|..:::::|||     |..:...|::    |..|.|:.:. ::|:..:..
Mouse   121 PDMVHNTVLELIKVAGHPDVVINNAA-----GNFISPSERLTPNGWKTITDIVLNGTAYVTLEIG 180

  Fly   192 LPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRT 256
            ..|::.||.::.:.:::|........:...|.:|:.:..:.|:.|.:....|:|.|.:.||.|:|
Mouse   181 KQLIKAQKGAAFLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKT 245

  Fly   257 K--FSK----ALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312
            |  ||:    ..:|.|     .:.:||.|||||.||:|.:.:||.|:.|.:|.|..|...||
Mouse   246 KGAFSRLDPTGRFEKE-----MIDRIPCGRLGTMEELANLATFLCSDYASWINGAVIRFDGG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 77/257 (30%)
fabG 67..316 CDD:235975 77/257 (30%)
Decr1NP_080448.1 TER_DECR_SDR_a 57..303 CDD:187627 77/257 (30%)
PRK07677 59..303 CDD:181077 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.