DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and SPR

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_003115.1 Gene:SPR / 6697 HGNCID:11257 Length:261 Species:Homo sapiens


Alignment Length:221 Identity:54/221 - (24%)
Similarity:86/221 - (38%) Gaps:39/221 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLA---EDGAAVVISSRKQKNVDSALAELR-KLNLNVHGLKCHV 129
            |...|.::|.::.|.|..:|..||   ..|:.:|:|:|.    |.||.:|. :|.....||:. |
Human     5 LGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARN----DEALRQLEAELGAERSGLRV-V 64

  Fly   130 SEPED------RKQLFEETISKFGKLN-----------ILVSNAAT--NPAVGGVLECDEKVWDK 175
            ..|.|      .:||       .|.|.           :|::||.:  :.:.|.|...|....:.
Human    65 RVPADLGAEAGLQQL-------LGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNN 122

  Fly   176 IFDVNVKSSYLLAKEALPLLRQQK--NSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKD 238
            .:.:|:.|...|....|.......  |.::|.:||:.....|:....|...|.|...|.:..|  
Human   123 YWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLA-- 185

  Fly   239 LAPEGIRVNCLAPGVIRTKFSKALYE 264
            |....:||...|||.:.|...:...|
Human   186 LEEPNVRVLNYAPGPLDTDMQQLARE 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 54/221 (24%)
fabG 67..316 CDD:235975 54/221 (24%)
SPRNP_003115.1 sepiapter_red 8..260 CDD:273660 53/218 (24%)
adh_short 9..212 CDD:278532 53/217 (24%)