DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_079606.3 Gene:Hsd17b14 / 66065 MGIID:1913315 Length:273 Species:Mus musculus


Alignment Length:257 Identity:87/257 - (33%)
Similarity:134/257 - (52%) Gaps:27/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHG---LKCHV 129
            |.:|||.|||..:.|||.||.:...:.||.||...:.:       |..|.|...:.|   :...|
Mouse     6 RYSGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDE-------AGGRALEQELSGTVFIPGDV 63

  Fly   130 SEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPL 194
            ::..|.:.|..||:|:||.|:.:|:||..:|......|...:.:.::.:||:..:|.|.|.|||.
Mouse    64 TQERDLQTLVSETLSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEVNLLGTYTLIKLALPH 128

  Fly   195 LRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFS 259
            ||:.: .:|:.:||:.|.........|..:|.|:..:|||.|.|.:..|:||||::||.|.|   
Mouse   129 LRKSR-GNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRHGVRVNCISPGNIWT--- 189

  Fly   260 KALYENESAN---------EAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITG-ESIVAGG 311
             .|:|..:|:         |..|:: |:||:|...|:|....||.|| |.:.|| |.:|.||
Mouse   190 -PLWEELAASTSDPRATILEGTLAQ-PLGRMGQPAEVAAAAVFLASE-ATFCTGLELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 87/257 (34%)
fabG 67..316 CDD:235975 87/257 (34%)
Hsd17b14NP_079606.3 NADB_Rossmann 1..256 CDD:304358 87/257 (34%)
fabG 8..251 CDD:235546 86/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.