DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and hsd17b8

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001005292.2 Gene:hsd17b8 / 64815 ZFINID:ZDB-GENE-010110-1 Length:256 Species:Danio rerio


Alignment Length:256 Identity:84/256 - (32%)
Similarity:134/256 - (52%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAEL-RKLNLNVH-GLKCHVS 130
            ||..::.:||....|||.|:.:|.|.:||:||::.|.:::.:..|..| |:.....| .|...||
Zfish     6 RLISRLTLVTGGGSGIGRAVCQRFATEGASVVVADRNEESANQTLELLPREHRGQEHMALGVDVS 70

  Fly   131 EPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAK---EAL 192
            ..:..::|......::.:...:..|||.......:|:.:|..:||:..||:|.::|:.:   :||
Zfish    71 SKDSVEKLVTSIQRRYFQPPSVCVNAAGITQDEFILKMEEDDFDKVIKVNLKGTFLVTQAVSKAL 135

  Fly   193 PLLRQQKNSSIVFVSSIAGYDAFELLG-----AYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPG 252
            ......| .||:.|.||.|     .:|     .|:.||..:.|||:.|||:|:..|||.||:.||
Zfish   136 VSAGSAK-GSIITVGSIVG-----KVGNIGQVNYASSKAGVQGLTRTAAKELSKFGIRCNCVLPG 194

  Fly   253 VIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGM 313
            .|.|..:..:  .|...:...|.||:||:|...|:|...:||.|:|:.||||.||...||:
Zfish   195 FITTPMTDKV--PEKVIDKITSIIPLGRMGEPAEVADACAFLASDDSRYITGVSIEVAGGL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 84/256 (33%)
fabG 67..316 CDD:235975 84/256 (33%)
hsd17b8NP_001005292.2 BKR_SDR_c 10..254 CDD:187594 82/252 (33%)
fabG 13..254 CDD:235546 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.