DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and spra

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001019601.2 Gene:spra / 554136 ZFINID:ZDB-GENE-050522-412 Length:261 Species:Danio rerio


Alignment Length:277 Identity:66/277 - (23%)
Similarity:118/277 - (42%) Gaps:51/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLA---EDGAAVVISSRKQKNVDSALAELRK-LNL 120
            |:.:|..|.|    .::|.::.|.|.|:|..:|   ..|:.:|:::|.::.    |.||:. |..
Zfish     2 STASGFGKAL----VIITGASRGFGRALALSVAARVSPGSVLVLAARSEEQ----LLELKSALTR 58

  Fly   121 NVHGL--KCHVSEPEDR------KQLFEET--ISKFGKLNILVSNAATNPAVGGVLE-CDE---- 170
            ...||  :|   .|.|.      ::|..||  |....:..:|..|||   ::|.|.. |.:    
Zfish    59 GETGLTVRC---VPVDLGCEAGVEKLIAETRDIQPDIQHLLLFHNAA---SLGDVSRYCRDFTNM 117

  Fly   171 KVWDKIFDVNVKSSYLLAKEALPLLRQQKNSS--IVFVSSIAGYDAFELLGAYSVSKTALIGLTK 233
            :..:....:||.|:..|....|....::...:  ||.:||:.....|.....|...|.|...:.:
Zfish   118 EELNSYLSLNVSSALCLTAGVLRTYPKRSGLTRVIVNISSLCALRPFPTWVQYCSGKAARDMMFR 182

  Fly   234 AAAKDLAPEGIRVNCLAPGVIRTKFSKALYENESANEAALSKI--------PMGRLGTSEEMAGV 290
            ..|:: .|| :||...|||.:.|..     :.|:.:..|.|::        ..|:|.|.::....
Zfish   183 VLAEE-EPE-LRVLNYAPGPLDTDM-----QREARSSCADSELRNTFSQMHANGQLLTCDQSIQK 240

  Fly   291 VSFLVSEDAGYITGESI 307
            :..::.||. |.:||.:
Zfish   241 LMSVLLEDK-YSSGEHL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 64/270 (24%)
fabG 67..316 CDD:235975 64/270 (24%)
spraNP_001019601.2 SPR-like_SDR_c 11..260 CDD:187625 63/268 (24%)
adh_short 12..211 CDD:278532 52/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.