DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and pecr

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001017727.1 Gene:pecr / 550422 ZFINID:ZDB-GENE-050417-232 Length:299 Species:Danio rerio


Alignment Length:261 Identity:86/261 - (32%)
Similarity:129/261 - (49%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNL------NVHGLKCHVS 130
            ||||||....|||.||...|.:.|.:|||||||.:.:.||..|| .|.:      .|..::|::.
Zfish    15 KVAVVTGGGTGIGKAITSELLQLGCSVVISSRKLERLKSAAEEL-TLKIPSSSPAKVTPIECNIR 78

  Fly   131 EPEDRKQLFEETISKFGKLNILVSNAA---TNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEAL 192
            ..::.|.|...|:...|:::.||:|..   ::||  .::..  |.|..:.|.|:..::|..:||.
Zfish    79 NEDEVKNLMASTLKLHGRIDFLVNNGGGQFSSPA--NMMSA--KGWKAVIDTNLNGTFLCCREAY 139

  Fly   193 PLLRQQKNSSIVFVSSIA----GYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGV 253
            .  ...|:...|.|:.||    |:......||   ::.|:..|||:.|.:.|..|:|:|.:|||.
Zfish   140 N--AWMKDHGGVIVNIIADMWKGFPGMAHTGA---ARAAVDNLTKSLAIEWAHSGVRINSVAPGT 199

  Fly   254 IRTKFSKALYENESANEAALSKI-----PMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGM 313
            |   .||...||.......|.|:     |..|||..||::..|.||:|..|.||||.::....|.
Zfish   200 I---ISKTAMENYKEYGPTLFKMSVPFSPAKRLGVPEEISPAVCFLLSPAANYITGATLKVDAGQ 261

  Fly   314 T 314
            :
Zfish   262 S 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 86/261 (33%)
fabG 67..316 CDD:235975 86/261 (33%)
pecrNP_001017727.1 fabG 28..263 CDD:235546 77/248 (31%)
TER_DECR_SDR_a 28..263 CDD:187627 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.