DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and hsd17b8

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001016671.1 Gene:hsd17b8 / 549425 XenbaseID:XB-GENE-490296 Length:255 Species:Xenopus tropicalis


Alignment Length:266 Identity:85/266 - (31%)
Similarity:131/266 - (49%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEP 132
            ||...:|:||....|||.||.:||:.:||:||:   ...::.||.|.|:.|:.|:.|.: |.:  
 Frog     6 RLKSMLALVTGGGSGIGRAICQRLSVEGASVVV---VDLDISSANATLQTLSHNLSGQE-HAA-- 64

  Fly   133 EDRKQLFEETISKFGKLNILVSNAATNPAV--------GGV------LECDEKVWDKIFDVNVKS 183
                  |...:||...:|.|:.......:|        .|:      |...|:.:|.:.:||:|.
 Frog    65 ------FATDVSKANHVNSLMQKIQGRYSVPPRIAISSAGITKDEFLLRLSEESFDSVLNVNLKG 123

  Fly   184 SYLLAKEALPLL--RQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRV 246
            .:|:.:.....:  ..:...||:.:.||.|.........|:.||..:.||||.|||:||..|||.
 Frog   124 PFLITQAVARAIVASGEHGGSIINIGSIVGKVGNLGQSNYAASKAGVEGLTKTAAKELAKFGIRC 188

  Fly   247 NCLAPGVIRTKFSKALYENESANEAALSK----IPMGRLGTSEEMAGVVSFLVSEDAGYITGESI 307
            |.:.||.|.|..:      :...:..|.|    :|:||||..|::|.|.:||.|:|:.||||.||
 Frog   189 NTVLPGFISTPMT------DKVPQKVLDKFAGMVPLGRLGYPEDIADVCAFLASDDSKYITGASI 247

  Fly   308 VAGGGM 313
            ...||:
 Frog   248 EVTGGL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 85/266 (32%)
fabG 67..316 CDD:235975 85/266 (32%)
hsd17b8NP_001016671.1 BKR_SDR_c 11..254 CDD:187594 83/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.