DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and zgc:113054

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001013468.1 Gene:zgc:113054 / 541322 ZFINID:ZDB-GENE-050320-9 Length:551 Species:Danio rerio


Alignment Length:254 Identity:75/254 - (29%)
Similarity:133/254 - (52%) Gaps:14/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEP 132
            ||.||||.||.:..|||.|.|..|.|.||.|.|....:...:....||....::...:...:|:|
Zfish   303 RLDGKVAYVTGAGQGIGRAFAHALGEAGAKVAIIDMDRGKAEDVAHELTLKGISSMAVVADISKP 367

  Fly   133 EDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQ 197
            :|.:::.::.::|:|.|:|..:||..|...... |...:.||:.|:||::.:::..:.|..::.:
Zfish   368 DDVQKMIDDIVTKWGTLHIACNNAGINKNSASE-ETSLEEWDQTFNVNLRGTFMCCQAAGRVMLK 431

  Fly   198 QKNSSIVFVSSIAG----YDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKF 258
            |....|:..:|:|.    :...:|  :|:.||..::.||:....:....|:||||::||::.|  
Zfish   432 QGYGKIINTASMASLIVPHPQKQL--SYNTSKAGVVKLTQTLGTEWIDRGVRVNCISPGIVDT-- 492

  Fly   259 SKALYENESAN---EAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMT 314
              .|..:||..   :..||.||.|||....::...|.:|.|:.:.|:||.::|..||.:
Zfish   493 --PLIHSESLEPLVQRWLSDIPAGRLAQVTDLQAAVVYLASDASDYMTGHNLVIEGGQS 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 75/254 (30%)
fabG 67..316 CDD:235975 75/254 (30%)
zgc:113054NP_001013468.1 YrrM 40..270 CDD:226607
AdoMet_MTases 59..270 CDD:302624
NADB_Rossmann 299..548 CDD:304358 74/251 (29%)
fabG 303..550 CDD:235546 75/254 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.