DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and pecr

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_031749362.1 Gene:pecr / 496922 XenbaseID:XB-GENE-1009809 Length:300 Species:Xenopus tropicalis


Alignment Length:258 Identity:77/258 - (29%)
Similarity:127/258 - (49%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KVAVVTASTDGIGFAIAKRLAEDGAAVVISSRK-------QKNVDSALAELRKLNLNVHGLKCHV 129
            |||:||....|||.|||..|...|.:|:|:|||       .|.:.|.:|......|.  .|:|::
 Frog    15 KVAIVTGGGTGIGKAIAAELLGLGCSVIIASRKLERLKETAKELTSRIAPASPALLT--PLQCNI 77

  Fly   130 SEPEDRKQLFEETISKFGKLNILVSNAATN-PAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALP 193
            ...|:.:.|.:.|:...|:::.||:|.... |:....:..  |.|:.:.|.|:..::...|....
 Frog    78 RREEEVETLVKSTLGLHGRIDFLVNNGGGQFPSPSEAISA--KGWNAVIDTNLTGTFYCCKAVYN 140

  Fly   194 LLRQQKNSSIV-FVSSI-AGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRT 256
            ...::...:|| .|:.: .|:......||   ::.|:..|||:.|.:.|..|:|:|.:|||.|  
 Frog   141 AWMKEHGGAIVNIVADMWKGFPGMAHTGA---ARAAVDNLTKSLAIEWAHSGVRINSVAPGTI-- 200

  Fly   257 KFSKALYEN-----ESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMT 314
             ||:...||     ....::.:.|||..|||..||::..|.||:|..:.:|:||:|....|.:
 Frog   201 -FSQTAVENYKDMGPQLFQSYIPKIPAKRLGLPEEVSPTVCFLLSPASSFISGETIKIDAGQS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 77/258 (30%)
fabG 67..316 CDD:235975 77/258 (30%)
pecrXP_031749362.1 TER_DECR_SDR_a 28..263 CDD:187627 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.