DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and zgc:101858

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001005597.1 Gene:zgc:101858 / 449555 ZFINID:ZDB-GENE-040927-13 Length:265 Species:Danio rerio


Alignment Length:255 Identity:87/255 - (34%)
Similarity:137/255 - (53%) Gaps:13/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLN----LNVHGLKCHV 129
            |..||.::|.::.|||...|...|:.||.:.::.|..:|:.....|.....    |.|.|   .:
Zfish    12 LNDKVTLITGASSGIGAGTALLFAKLGARLALNGRDVENLTKVAKECEACGAAKPLLVAG---DL 73

  Fly   130 SEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPL 194
            ::.|..::..||.|:.||:|::|| |:|...|:|.:...|...:||:..|||:|.|.|....:|.
Zfish    74 TDEETVRRTVEEVIAHFGRLDVLV-NSAGILAMGSIETTDMAQYDKVMSVNVRSIYHLTHLCVPH 137

  Fly   195 LRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFS 259
            |.:.| .|||.|||:.|..:|..:.||.:||:|:...|:..|.:||.:.:|||.:.||||.|:..
Zfish   138 LIKTK-GSIVNVSSVNGQRSFPGVLAYCMSKSAIDQFTRCVALELASKQVRVNSVCPGVIITEVH 201

  Fly   260 K--ALYENESANEAALSKI--PMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMTA 315
            |  .|.|.:.|......|:  .:||.|..:|:|..::||.|:.|.:|||.::...||..|
Zfish   202 KRAGLDEEQYAQFIEKCKVTHALGRPGEVDEVAHAIAFLASDAATFITGVNLPVDGGRHA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 87/255 (34%)
fabG 67..316 CDD:235975 87/255 (34%)
zgc:101858NP_001005597.1 fabG 11..260 CDD:235546 86/252 (34%)
SDR_c11 12..262 CDD:187622 87/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.