DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and MGC79752

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001005019.1 Gene:MGC79752 / 448527 XenbaseID:XB-GENE-5820599 Length:264 Species:Xenopus tropicalis


Alignment Length:260 Identity:84/260 - (32%)
Similarity:142/260 - (54%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLK-----CH 128
            |..||.:||.::.|||...|...|..||.:.::.|.::.:........:.:    |:|     ..
 Frog    11 LKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEEKLQETAQGCEQFS----GMKPLLVPGD 71

  Fly   129 VSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALP 193
            :::.|..:::.|:|::.||:|::|| |:....|:|.|.....:.:|::.:|||:|.:.|...|:|
 Frog    72 LTDEESVRKIVEQTVAHFGRLDVLV-NSGGILAMGTVENTSLQDFDRVMNVNVRSLFYLTHLAVP 135

  Fly   194 LLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKF 258
            .|.|.| .:||.|||:.|..:|..:.||.:||:|:..||:.||.:|||:.:|||.:.||||.|. 
 Frog   136 HLIQTK-GNIVNVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITD- 198

  Fly   259 SKALYENESANEAALSKI--------PMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMTA 315
               ::.....||...|:.        .:||.||.:|:|..::||.|:.|.:|||.::...||..|
 Frog   199 ---VHRRAGLNEEQYSEFIQRTQHTHALGRPGTVDEVAKTIAFLASDAASFITGVTMPVDGGRHA 260

  Fly   316  315
             Frog   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 84/260 (32%)
fabG 67..316 CDD:235975 84/260 (32%)
MGC79752NP_001005019.1 SDR_c11 11..261 CDD:187622 84/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.