DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and CG7601

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:206 Identity:52/206 - (25%)
Similarity:101/206 - (49%) Gaps:25/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLN----VHGLKCH 128
            :|.|||.::|.::.|:|.::|......|..|::::|:.:.::....:|..|:::    ...|...
  Fly    50 QLPGKVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTVLPLD 114

  Fly   129 VSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGV----------LECDEKVWDKIFDVNVKS 183
            ::|.....:.....::.:.:::||::|       ||:          ::.|.||    ..||...
  Fly   115 LAELNSIPEFVTRVLAVYNQVDILINN-------GGISVRADVASTAVDVDLKV----MVVNYFG 168

  Fly   184 SYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNC 248
            |..|.|..||.:.::.:..|.|:||:.|..|.....|||.||.|:.....:...::|.:.|.|:|
  Fly   169 SVALTKALLPSMVKRGSGHICFISSVQGKFAIPQRAAYSASKHAMQAFADSLRAEVANKNINVSC 233

  Fly   249 LAPGVIRTKFS 259
            ::||.|||:.|
  Fly   234 VSPGYIRTQLS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 52/206 (25%)
fabG 67..316 CDD:235975 52/206 (25%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 52/205 (25%)
PRK06181 53..314 CDD:235726 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.