DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and CG31549

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:264 Identity:88/264 - (33%)
Similarity:139/264 - (52%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNV----DSALAELRKLNLNVHGLK 126
            |.....||.:||.::.|||.:.|..||:.|..:||..|.::.:    |:.:|......|.   |:
  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLE---LQ 62

  Fly   127 CHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDE------KVWDKIFDVNVKSSY 185
            ..:::..:.:|:...|::|.|::::||:||       |:||...      :.:|::.:.||:|.|
  Fly    63 ADMTKEAEVQQIVGATLAKHGRIDVLVNNA-------GILETGSIEATSLEQFDRLMNTNVRSLY 120

  Fly   186 LLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLA 250
            .|...|.|.|.:.| .:||.|||:.|..||..:.||:|||.|:...|...|.:|||:|:|||.:.
  Fly   121 QLTMLATPELVKTK-GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVN 184

  Fly   251 PGVIRTKFSK--ALYENESANEAALSKI--PMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGG 311
            ||||.|...|  .:.|...|......||  .:||.|..:|:|..::||.|:.|.:.||.|:...|
  Fly   185 PGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDG 249

  Fly   312 GMTA 315
            |..|
  Fly   250 GRHA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 87/263 (33%)
fabG 67..316 CDD:235975 87/263 (33%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 87/261 (33%)
fabG 4..251 CDD:235975 85/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.