DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and decr2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_005162937.1 Gene:decr2 / 406623 ZFINID:ZDB-GENE-040426-2612 Length:301 Species:Danio rerio


Alignment Length:305 Identity:85/305 - (27%)
Similarity:127/305 - (41%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DQNSNNYSRKLVGPNLNQCHKRLSSSSQSSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGA 96
            |:..|.|:. :..|:|                     |:.:||.:|....||||.||:.|...|.
Zfish    18 DECMNKYTH-IYSPDL---------------------LSDQVAFITGGGSGIGFRIAEVLMRHGC 60

  Fly    97 AVVISSRKQKNVDSALAELRKLNLNVHGLKC-----HVSEPEDRKQLFEETISKFGKLNILVSNA 156
            ..||:||..:.:..|..:|    .:..|.:|     .|.:||......:||:..||:::||::||
Zfish    61 DTVIASRNLEKISQAAKKL----TSTTGRRCLPIAMDVRQPETILAAVDETLKTFGRVDILINNA 121

  Fly   157 ATN---PAVG---------------GVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQQKNSSI 203
            |.|   ||..               |.....:.::||.|                   :....||
Zfish   122 AGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWF-------------------KDHGGSI 167

  Fly   204 VFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIR-TKFSKALYENES 267
            |.:|:..||....|......:|.|...:|:..|.:..|.|:|||.:|||.|. |:..:.|..:.:
Zfish   168 VNISATLGYRGQALQVHAGSAKAANDAMTRHLAVEWGPSGVRVNTVAPGPISGTEGYRRLGGSHA 232

  Fly   268 ANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312
            ....|...||:.|.|...|||..|.||.|..:.|:||..:||.||
Zfish   233 ETAGAFHSIPLQRAGNKTEMAHAVLFLASRASSYVTGSVLVADGG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 80/270 (30%)
fabG 67..316 CDD:235975 80/270 (30%)
decr2XP_005162937.1 PRK07576 33..283 CDD:236056 80/268 (30%)
TER_DECR_SDR_a 33..280 CDD:187627 80/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.