DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and cbr4

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_991219.2 Gene:cbr4 / 402954 ZFINID:ZDB-GENE-040426-1796 Length:237 Species:Danio rerio


Alignment Length:245 Identity:86/245 - (35%)
Similarity:131/245 - (53%) Gaps:17/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVH-GLKCHVSEPEDR 135
            ::|||...:.|||.|::|.||:.|..:|:.||   |.::|.|..:.|....| ||.|.||:.|:.
Zfish     3 RLAVVFGGSRGIGRAVSKLLAQRGHRIVLLSR---NKEAAQATAQSLPGENHLGLSCDVSKEEEV 64

  Fly   136 KQLFEETISK-FGKLNILVSNAATN-PAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQQ 198
            ::.| |||:| .|.:..||:.|..| .|:  :|....:....:...|:..|.|..|.|:..:...
Zfish    65 QKAF-ETINKTCGTVGFLVNAAGINRDAL--LLRSKSEDMLSVLHTNLLGSMLTCKAAVRNMLSH 126

  Fly   199 KNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFSKALY 263
             ..:||.:.|:.|.........||.||..|.|.|::.||::|...||||.:|||:|.|..:..| 
Zfish   127 -GGAIVNIGSVVGVKGNAGQCVYSASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDMTAGL- 189

  Fly   264 ENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGM 313
                |.|||:..||:||.|...|:|..|.||:  ::.||||:.::..||:
Zfish   190 ----AEEAAVRTIPLGRFGEPAEVAQAVLFLL--ESPYITGQILLVDGGL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 86/245 (35%)
fabG 67..316 CDD:235975 86/245 (35%)
cbr4NP_991219.2 fabG 1..235 CDD:235546 86/245 (35%)
NADB_Rossmann 3..233 CDD:304358 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.