DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and CG8757

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster


Alignment Length:205 Identity:52/205 - (25%)
Similarity:98/205 - (47%) Gaps:18/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELR-KLNLNVHGLKCHV 129
            |:|...|||||:.::.|||.|..:.|...|..||..:|:.:.|:...:.|. :....:|.:||.:
  Fly     1 MERWCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDI 65

  Fly   130 SEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEK----VWDKIFDVNVKSSYLLAKE 190
            ::.:...:.|:.|..:.|.:::|||||    .:.|..|..|:    ......:.|:..:....:|
  Fly    66 TQEDQVLKAFDWTCRQLGGVDVLVSNA----GIIGTGELSERDDGPAMRSTIETNIMGTVYCVRE 126

  Fly   191 AL-PLLRQQKNSSIVFVSSIAGYDAFEL------LGAYSVSKTALIGLTKAAAKDLA--PEGIRV 246
            :. .:.|:.....:|.|:|:|||....|      |..|..:|.||..:.:...::..  ...:||
  Fly   127 SFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRV 191

  Fly   247 NCLAPGVIRT 256
            :.::||::.|
  Fly   192 STVSPGIVDT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 51/204 (25%)
fabG 67..316 CDD:235975 51/204 (25%)
CG8757NP_648664.2 YdfG 1..252 CDD:226674 52/205 (25%)
NADB_Rossmann 1..247 CDD:304358 52/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.