DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and dhrs1

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001002205.1 Gene:dhrs1 / 368670 ZFINID:ZDB-GENE-030616-591 Length:310 Species:Danio rerio


Alignment Length:262 Identity:75/262 - (28%)
Similarity:122/262 - (46%) Gaps:22/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPE 133
            |:|.:.|||.::.|||..||.:|:|.||.|.|:.|::|::....||:.:.......:.|..|:.|
Zfish     3 LSGWICVVTGASRGIGRGIALQLSEAGATVYITGRQEKSLKQTAAEVAERGGRCLPVVCDSSKEE 67

  Fly   134 DRKQLFEET-ISKFGKLNILVSNAATNPAVGGVL--------ECDEKVWDKIFDVNVKSSYLLAK 189
            |.|:|||.. ..:.|:|:|||:||..  .|..:|        |.|..:||.|.:..::..|..:.
Zfish    68 DIKELFERVEREQNGRLDILVNNAYA--GVQAILDNVSKKFWEVDPGIWDTINNTGLRGHYFCSV 130

  Fly   190 EALPLLRQQKNSSIVFVSSIAGYD-AFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGV 253
            .|..|:..|....||.:||:.|.. .|.:  .|.|.|.|...:......:|...|:....|.||.
Zfish   131 YAARLMVAQGKGLIVVISSMGGLRYLFNV--PYGVGKAACDRMAADMGIELKKRGVASVSLWPGA 193

  Fly   254 IRTKFSKALYENESANEAALSKI-PMGRLGTSEEMAGVVSFLVSEDAGY--ITGESIVAGGGMTA 315
            ::|:..|.....:.......||. .:...|.:.|::|.....:::|.|.  :||:.:     ||.
Zfish   194 VQTETIKQYMSQDEGPPGFDSKYKDVFTNGETTELSGRCIVELAKDKGLMSMTGQVL-----MTC 253

  Fly   316 RL 317
            .|
Zfish   254 EL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 74/260 (28%)
fabG 67..316 CDD:235975 74/259 (29%)
dhrs1NP_001002205.1 PRK08303 1..267 CDD:236229 75/262 (29%)
DHRS1-like_SDR_c 3..268 CDD:187664 75/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.